CCL3L1 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9426
Artikelname: CCL3L1 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9426
Hersteller Artikelnummer: P9426
Alternativnummer: ABN-P9426-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CCL3L1 (P16619, 26 a.a. - 93 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 6349
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMSLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
Target-Kategorie: CCL3L1
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.