CCL27 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9428
Artikelname: CCL27 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9428
Hersteller Artikelnummer: P9428
Alternativnummer: ABN-P9428-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CCL27 (Q9Y4X3, 25 a.a. - 112 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 10850
Puffer: In 10mM sodium citrate pH 3.5 (10% glycerol)
Formulierung: Liquid
Sequenz: MFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Target-Kategorie: CCL27
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.