CXCL16 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9430
Artikelname: CXCL16 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9430
Hersteller Artikelnummer: P9430
Alternativnummer: ABN-P9430-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human CXCL16 (Q9H2A7, 30 a.a. - 118 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 58191
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: NEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLP
Target-Kategorie: CXCL16
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.