CXCL17 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9432
Artikelname: CXCL17 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9432
Hersteller Artikelnummer: P9432
Alternativnummer: ABN-P9432-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human CXCL17 (Q6UXB2, 22 a.a. - 119 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 284340
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: SSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL
Target-Kategorie: CXCL17
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.