CXCL17 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9433
Artikelname: CXCL17 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9433
Hersteller Artikelnummer: P9433
Alternativnummer: ABN-P9433-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CXCL17 (Q6UXB2, 22 a.a. - 119 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 284340
Puffer: In 20mM Tris-HCl pH 8.0 (0.4 M Urea and 10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL
Target-Kategorie: CXCL17
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.