CXCL17 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9433
- Bilder (0)
Artikelname: | CXCL17 (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9433 |
Hersteller Artikelnummer: | P9433 |
Alternativnummer: | ABN-P9433-2 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human CXCL17 (Q6UXB2, 22 a.a. - 119 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 284340 |
Puffer: | In 20mM Tris-HCl pH 8.0 (0.4 M Urea and 10% glycerol) |
Formulierung: | Liquid |
Sequenz: | MGSSHHHHHHSSGLVPRGSHMSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL |
Target-Kategorie: | CXCL17 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |