Cxcl17 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P9434
Artikelname: Cxcl17 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P9434
Hersteller Artikelnummer: P9434
Alternativnummer: ABN-P9434-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Cxcl17 (D4A875, 23 a.a. - 119 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 308436
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: SPNQEVARHHGDQHQAPRRWLWEGGQECDCKDWSLRVSKRKTTAVLEPPRKQCPCDHVKGSEKKNRRQKHHRKSQRPSRTCQQFLKRCQLASFTLPL
Target-Kategorie: Cxcl17
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.