Ccl11 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P9442
Artikelname: Ccl11 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P9442
Hersteller Artikelnummer: P9442
Alternativnummer: ABN-P9442-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Ccl11 (P97545, 24 a.a. - 97 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 29397
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: HPGSIPTSCCFTMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTKLGKEICADPKKKWVQDATKHLDQKLQTPKP
Target-Kategorie: Ccl11
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.