Ccl24 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P9446
Artikelname: Ccl24 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P9446
Hersteller Artikelnummer: P9446
Alternativnummer: ABN-P9446-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Ccl24 (Q5PPP2, 27 a.a. - 119 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 288593
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: VTIPSSCCVTFISKKIPVNRVISYQLANGSICPKAGVIFITKKGHKICTDPKLPWVQKHIKNLDAKRNQPSEGAKALGPKFVIQKLRGNSTKV
Target-Kategorie: Ccl24
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.