CCL21 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9448
Artikelname: CCL21 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9448
Hersteller Artikelnummer: P9448
Alternativnummer: ABN-P9448-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human CCL21 (O00585, 24 a.a. - 134 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 6366
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCRKTERSQTPKGP
Target-Kategorie: CCL21
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.