TAFA5 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9451
- Bilder (0)
Artikelname: | TAFA5 (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9451 |
Hersteller Artikelnummer: | P9451 |
Alternativnummer: | ABN-P9451-2 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human TAFA5 (Q7Z5A7, 26 a.a. - 125 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 25817 |
Puffer: | In 20mM Tris buffer pH 7.5 (50mM NaCl,10% (w/v) glycerol) |
Formulierung: | Liquid |
Sequenz: | MKHHHHHHASQFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS |
Target-Kategorie: | FAM19A5 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |