TAFA5 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9451
Artikelname: TAFA5 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9451
Hersteller Artikelnummer: P9451
Alternativnummer: ABN-P9451-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human TAFA5 (Q7Z5A7, 26 a.a. - 125 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 25817
Puffer: In 20mM Tris buffer pH 7.5 (50mM NaCl,10% (w/v) glycerol)
Formulierung: Liquid
Sequenz: MKHHHHHHASQFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS
Target-Kategorie: FAM19A5
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.