Cx3cl1 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P9455
Artikelname: Cx3cl1 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P9455
Hersteller Artikelnummer: P9455
Alternativnummer: ABN-P9455-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Cx3cl1 (O55145, 25 a.a. - 100 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 89808
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: QHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTRNG
Target-Kategorie: Cx3cl1
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.