Cxcl1 (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P9461
Artikelname: Cxcl1 (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P9461
Hersteller Artikelnummer: P9461
Alternativnummer: ABN-P9461-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Mouse Cxcl1 (P12850, 25 a.a. - 96 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 14825
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Target-Kategorie: Cxcl1
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.