Cxcl1 (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P9462
Artikelname: Cxcl1 (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P9462
Hersteller Artikelnummer: P9462
Alternativnummer: ABN-P9462-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Mouse Cxcl1 (P12850, 25 a.a. - 96 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 14825
Puffer: In 20mM Tris-HCl pH 8.0 (0.1 M NaCl and 10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSHMAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Target-Kategorie: Cxcl1
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.