Cxcl1 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P9463
Artikelname: Cxcl1 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P9463
Hersteller Artikelnummer: P9463
Alternativnummer: ABN-P9463-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Cxcl1 (P14095, 25 a.a. - 96 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 81503
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
Target-Kategorie: Cxcl1
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.