Cxcl2 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P9467
Artikelname: Cxcl2 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P9467
Hersteller Artikelnummer: P9467
Alternativnummer: ABN-P9467-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Cxcl2 (P30348, 28 a.a. - 100 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 114105
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN
Target-Kategorie: Cxcl2
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.