CXCL3 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9470
- Bilder (0)
Artikelname: | CXCL3 (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9470 |
Hersteller Artikelnummer: | P9470 |
Alternativnummer: | ABN-P9470-2 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human CXCL3 (P19875, 35 a.a. - 107 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 2921 |
Puffer: | In 20mM Tris-HCl pH 8.0 (1 M DTT and 20% glycerol) |
Formulierung: | Liquid |
Sequenz: | MGSSHHHHHHSSGLVPRGSHMASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN |
Target-Kategorie: | CXCL3 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |