CXCL3 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9470
Artikelname: CXCL3 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9470
Hersteller Artikelnummer: P9470
Alternativnummer: ABN-P9470-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CXCL3 (P19875, 35 a.a. - 107 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 2921
Puffer: In 20mM Tris-HCl pH 8.0 (1 M DTT and 20% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Target-Kategorie: CXCL3
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.