Cxcl3 (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P9472
Artikelname: Cxcl3 (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P9472
Hersteller Artikelnummer: P9472
Alternativnummer: ABN-P9472-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Mouse Cxcl3 (Q6W5C0, 32 a.a. - 100 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 330122
Puffer: In 20mM Tris-HCl pH 8.0 (5 M DTT, 0.15 M NaCl and 50% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSHMAVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
Target-Kategorie: Cxcl3
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.