Cxcl3 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P9473
Artikelname: Cxcl3 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P9473
Hersteller Artikelnummer: P9473
Alternativnummer: ABN-P9473-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Cxcl3 (Q10746, 33 a.a. - 101 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 171551
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKSS
Target-Kategorie: Cxcl3
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.