CCL14 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9475
Artikelname: CCL14 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9475
Hersteller Artikelnummer: P9475
Alternativnummer: ABN-P9475-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human CCL14 (Q16627, 22 a.a. - 93 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 6358
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHS_x005FVCTNPSDKWVQDYIKDMKEN
Target-Kategorie: CCL14
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.