CCL14 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9477
Artikelname: CCL14 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9477
Hersteller Artikelnummer: P9477
Alternativnummer: ABN-P9477-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CCL14 (Q16627, 20 a.a. - 93 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 6358
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Target-Kategorie: CCL14
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.