CCL1 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9479
Artikelname: CCL1 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9479
Hersteller Artikelnummer: P9479
Alternativnummer: ABN-P9479-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CCL1 (P22362, 24 a.a. - 96 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 6346
Puffer: In 20mM Tris-HCl pH 7.5 (1 M DTT, 50 mM NaCl and 10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Target-Kategorie: CCL1
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.