Cxcl10 (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P9491
Artikelname: Cxcl10 (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P9491
Hersteller Artikelnummer: P9491
Alternativnummer: ABN-P9491-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Mouse Cxcl10 (P17515, 22 a.a. - 98 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 15945
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Target-Kategorie: Cxcl10
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.