Cxcl10 (Guinea Pig) Recombinant Protein, E. coli

Artikelnummer: ABN-P9494
Artikelname: Cxcl10 (Guinea Pig) Recombinant Protein, E. coli
Artikelnummer: ABN-P9494
Hersteller Artikelnummer: P9494
Alternativnummer: ABN-P9494-50
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Guinea Pig Cxcl10 (A0A286XCT1, 22 a.a. - 97 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 100714889
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: IPHSRTIRCTCIETSTQPVNPKSFKKLEIIPASQSCPRVEIIATMKMNGEKRCLDPESKVIKNLLKAVRKERSKRS
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.