CCL4L1 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9498
Artikelname: CCL4L1 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9498
Hersteller Artikelnummer: P9498
Alternativnummer: ABN-P9498-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CCL4L1 (Q8NHW4, 24 a.a. - 92 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 388372
Puffer: In 10mM Sodium citrate pH 3.5 (10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSHMAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
Target-Kategorie: CCL4L2
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.