Xcl1 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P9504
Artikelname: Xcl1 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P9504
Hersteller Artikelnummer: P9504
Alternativnummer: ABN-P9504-100
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Xcl1 (P51672, 22 a.a. - 114 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 171371
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG
Target-Kategorie: Xcl1
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.