Ccl2 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P9511
Artikelname: Ccl2 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P9511
Hersteller Artikelnummer: P9511
Alternativnummer: ABN-P9511-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Ccl2 (P14844, 24 a.a. - 148 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 24770
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN
Target-Kategorie: Ccl2
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.