Ccl2 (Rat) Recombinant Protein, Insect

Artikelnummer: ABN-P9512
Artikelname: Ccl2 (Rat) Recombinant Protein, Insect
Artikelnummer: ABN-P9512
Hersteller Artikelnummer: P9512
Alternativnummer: ABN-P9512-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Rat Ccl2 (P14844, 24 a.a. - 148 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 24770
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: ADPQPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTENHHHHHH
Target-Kategorie: Ccl2
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.