CCL22 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9523
Artikelname: CCL22 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9523
Hersteller Artikelnummer: P9523
Alternativnummer: ABN-P9523-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CCL22 (O00626, 25 a.a. - 93 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 6367
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ
Target-Kategorie: CCL22
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.