Ccl22 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P9525
Artikelname: Ccl22 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P9525
Hersteller Artikelnummer: P9525
Alternativnummer: ABN-P9525-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Ccl22 (Q5I0L5, 25 a.a. - 92 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 117551
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA
Target-Kategorie: Ccl22
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.