CCL28 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9526
Artikelname: CCL28 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9526
Hersteller Artikelnummer: P9526
Alternativnummer: ABN-P9526-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human CCL28 (Q9NRJ3, 19 a.a. - 127 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 56477
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
Target-Kategorie: CCL28
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.