CCL28 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9527
- Bilder (0)
Artikelname: | CCL28 (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9527 |
Hersteller Artikelnummer: | P9527 |
Alternativnummer: | ABN-P9527-20 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human CCL28 (Q9NRJ3, 23 a.a. - 127 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 56477 |
Puffer: | In 10mM Sodium citrate pH 3.5 (10% glycerol) |
Formulierung: | Liquid |
Sequenz: | MGSSHHHHHHSSGLVPRGSHMILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY |
Target-Kategorie: | CCL28 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |