CCL28 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9527
Artikelname: CCL28 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9527
Hersteller Artikelnummer: P9527
Alternativnummer: ABN-P9527-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CCL28 (Q9NRJ3, 23 a.a. - 127 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 56477
Puffer: In 10mM Sodium citrate pH 3.5 (10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
Target-Kategorie: CCL28
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.