Ccl28 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P9529
Artikelname: Ccl28 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P9529
Hersteller Artikelnummer: P9529
Alternativnummer: ABN-P9529-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Ccl28 (Q91Y39, 20 a.a. - 135 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 114492
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: SEAILPIASSCCTEVSHHIPRRLLERVNSCSIQRADGDCDLAAVILHVKRRRICVSPHNPTLKRWMSASEMKNGKENLCPRKKQDSGKDRKGHTPRKHGKHGTRRIHGTHDHEAPR
Target-Kategorie: Ccl28
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.