CXCL9 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9531
- Bilder (0)
Artikelname: | CXCL9 (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9531 |
Hersteller Artikelnummer: | P9531 |
Alternativnummer: | ABN-P9531-20 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human CXCL9 (Q07325, 23 a.a. - 125 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 4283 |
Puffer: | In 20mM Tris-HCl pH 8.0 (0.15 M NaCl and 30% glycerol) |
Formulierung: | Liquid |
Sequenz: | MGSSHHHHHHSSGLVPRGSHMGSTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
Target-Kategorie: | CXCL9 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |