CXCL9 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9531
Artikelname: CXCL9 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9531
Hersteller Artikelnummer: P9531
Alternativnummer: ABN-P9531-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CXCL9 (Q07325, 23 a.a. - 125 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 4283
Puffer: In 20mM Tris-HCl pH 8.0 (0.15 M NaCl and 30% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Target-Kategorie: CXCL9
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.