Ccl4 (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P9540
Artikelname: Ccl4 (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P9540
Hersteller Artikelnummer: P9540
Alternativnummer: ABN-P9540-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Mouse Ccl4 (P14097, 24 a.a. - 92 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 20303
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Target-Kategorie: Ccl4
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.