Ccl20 (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P9549
Artikelname: Ccl20 (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P9549
Hersteller Artikelnummer: P9549
Alternativnummer: ABN-P9549-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Mouse Ccl20 (O89093, 28 a.a. - 97 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 20297
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
Target-Kategorie: Ccl20
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.