CCL18 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9550
Artikelname: CCL18 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9550
Hersteller Artikelnummer: P9550
Alternativnummer: ABN-P9550-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human CCL18 (P55774, 21 a.a. - 89 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 6362
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Target-Kategorie: CCL18
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.