CCL18 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9551
Artikelname: CCL18 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9551
Hersteller Artikelnummer: P9551
Alternativnummer: ABN-P9551-5
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CCL18 (P55774, 22 a.a. - 89 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 6362
Puffer: In 10 mM Sodium Citrate buffer pH3.5 (10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSHMQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Target-Kategorie: CCL18
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.