PPBP (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9555
Artikelname: PPBP (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9555
Hersteller Artikelnummer: P9555
Alternativnummer: ABN-P9555-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human PPBP (P02775, 35 a.a. - 128 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 5473
Puffer: In 20mM Tris-HCl pH 7.5 (1 M DTT and 10% glycerol)
Formulierung: Liquid
Sequenz: MSSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Target-Kategorie: PPBP
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.