Ppbp (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P9556
Artikelname: Ppbp (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P9556
Hersteller Artikelnummer: P9556
Alternativnummer: ABN-P9556-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Ppbp (Q99ME0, 46 a.a. - 111 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 246358
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI
Target-Kategorie: Ppbp
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.