PF4 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9558
Artikelname: PF4 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9558
Hersteller Artikelnummer: P9558
Alternativnummer: ABN-P9558-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human PF4 (P02776, 32 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 5196
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLY
Target-Kategorie: PF4
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.