PF4V1 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9563
Artikelname: PF4V1 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9563
Hersteller Artikelnummer: P9563
Alternativnummer: ABN-P9563-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human PF4V1 (P10720, 31 a.a. - 104 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 5197
Puffer: In 20mM Tris-HCl pH 8.0 (0.2 M NaCl, 1 mM DTT and 50% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSFARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
Target-Kategorie: PF4V1
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.