Cxcl12 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P9573
Artikelname: Cxcl12 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P9573
Hersteller Artikelnummer: P9573
Alternativnummer: ABN-P9573-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Cxcl12 (Q9QZD1 22 a.a. - 89 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 24772
Puffer: Lyophilized from sterile distilled Water is 0.5 mg/mL
Formulierung: Lyophilized
Sequenz: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNK
Target-Kategorie: Cxcl12
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.