SDF2 (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9581
Artikelname: SDF2 (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9581
Hersteller Artikelnummer: P9581
Alternativnummer: ABN-P9581-5
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human SDF2 (Q99470, 19 a.a. - 211 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 6388
Puffer: In 50mM Tris-HCl pH 8.0 (0.1 M NaCl, 0.1 mM PMSF, 0.5 mM EDTA and 10% glycerol)
Formulierung: Liquid
Sequenz: ADPSSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAELHHHHHH
Target-Kategorie: SDF2
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.