SDF2 (Human) Recombinant Protein, Insect
Artikelnummer:
ABN-P9581
- Bilder (0)
Artikelname: | SDF2 (Human) Recombinant Protein, Insect |
Artikelnummer: | ABN-P9581 |
Hersteller Artikelnummer: | P9581 |
Alternativnummer: | ABN-P9581-5 |
Hersteller: | Abnova |
Wirt: | Insect |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human SDF2 (Q99470, 19 a.a. - 211 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells. |
Tag: | His |
UniProt: | 6388 |
Puffer: | In 50mM Tris-HCl pH 8.0 (0.1 M NaCl, 0.1 mM PMSF, 0.5 mM EDTA and 10% glycerol) |
Formulierung: | Liquid |
Sequenz: | ADPSSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAELHHHHHH |
Target-Kategorie: | SDF2 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |