CCL17 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9582
Artikelname: CCL17 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9582
Hersteller Artikelnummer: P9582
Alternativnummer: ABN-P9582-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human CCL17 (Q92583, 24 a.a. - 94 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 6361
Puffer: Lyophilized from sterile distilled Water is 0.5 mg/mL
Formulierung: Lyophilized
Sequenz: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Target-Kategorie: CCL17
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.