CCL17 (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9583
Artikelname: CCL17 (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9583
Hersteller Artikelnummer: P9583
Alternativnummer: ABN-P9583-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CCL17 (Q92583, 24 a.a. - 94 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 6361
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Target-Kategorie: CCL17
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.