CCL25 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9588
Artikelname: CCL25 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9588
Hersteller Artikelnummer: P9588
Alternativnummer: ABN-P9588-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CCL25 (O15444, 24 a.a. - 150 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 6370
Puffer: In 20mM Tris-HCl pH 8.0 (10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSHMQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Target-Kategorie: CCL25
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.