AICDA (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9590
Artikelname: AICDA (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9590
Hersteller Artikelnummer: P9590
Alternativnummer: ABN-P9590-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human AICDA (Q9GZX7, 1 a.a. - 198 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 57379
Puffer: In 20mM Tris-HCl pH 8.0 (0.4 M Urea and 10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMDSLLMNRRKFLYQFKNVRWAKGRRETYLCYVVKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIAIMTFKDYFYCWNTFVENHERTFKAWEGLHENSVRLSRQLRRILLPLYEVDDLRDAFRTLGL
Target-Kategorie: AICDA
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.