CDO1 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9595
Artikelname: CDO1 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9595
Hersteller Artikelnummer: P9595
Alternativnummer: ABN-P9595-50
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CDO1 (Q16878, 1 a.a. - 170 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 1036
Puffer: In 20mM Tris-HCl pH 8.0 (1 mM DTT and 10% glycerol)
Formulierung: Liquid
Sequenz: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQR
Target-Kategorie: CDO1
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.