FTCD (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9596
Artikelname: FTCD (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9596
Hersteller Artikelnummer: P9596
Alternativnummer: ABN-P9596-20
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human FTCD (O95954, 1 a.a. - 541 a.a.) full recombinant protein with His tag at N-terminus expressed in Sf9 cells.
Tag: His
UniProt: 10841
Puffer: In 16mM HEPES buffer pH 7.6 (240 mM NaCl and 20% glycerol)
Formulierung: Liquid
Sequenz: MHHHHHHMSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALH
Target-Kategorie: FTCD
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.