FTCD (Human) Recombinant Protein, Insect
Artikelnummer:
ABN-P9596
- Bilder (0)
Artikelname: | FTCD (Human) Recombinant Protein, Insect |
Artikelnummer: | ABN-P9596 |
Hersteller Artikelnummer: | P9596 |
Alternativnummer: | ABN-P9596-20 |
Hersteller: | Abnova |
Wirt: | Insect |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human FTCD (O95954, 1 a.a. - 541 a.a.) full recombinant protein with His tag at N-terminus expressed in Sf9 cells. |
Tag: | His |
UniProt: | 10841 |
Puffer: | In 16mM HEPES buffer pH 7.6 (240 mM NaCl and 20% glycerol) |
Formulierung: | Liquid |
Sequenz: | MHHHHHHMSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALH |
Target-Kategorie: | FTCD |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |