CDK2AP2 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9600
Artikelname: CDK2AP2 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9600
Hersteller Artikelnummer: P9600
Alternativnummer: ABN-P9600-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CDK2AP2 (O75956, 1 a.a. - 126 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 10263
Puffer: In 20mM Tris-HCl pH 8.0 (0.2 M NaCl, 2mM DTT and 50% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSMSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
Target-Kategorie: CDK2AP2
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.